IGF LR3

IGF-1 LR3

The most effective form of IGF is Long R3 IGF-1, it has been chemically altered and has had amino acid changes, which cause it to avoid binding to proteins in the human body and allow it to have a much longer half-life, around 20-30 hours. “Long R3 IGF-1 is an 83 amino acid analog of IGF-1 comprising the complete human IGF-1 sequence with the substation of an Arg(R) for the Glu (E) at position three, hence R3, and a 13 amino acid extension peptide at the N terminus. This analog of IGF-1 has been produced with the purpose of increasing the biological activity of the IGF peptide.”

Categories: .

Description: The LR3 is a long-term analog of human IGF-1, specifically designed and manufactured for mammalian cell culture to support large-scale manufacturing of recombinant biopharmaceuticals. Recombinant Human LR3 Insulin Like Growth Factor-1 produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 83 amino acids and having a molecular mass of 9.1kDa.

Synonyms: R3 IGF1, R3 IGF-1, R3IGF1, R3IGF-1, LONG IGF1, LONG IGF-1, LONG R3 IGF1,

LONG R3IGF1, LONG R3 IGF-1, LONG R3IGF-1.

Source: Escherichia Coli.

Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Amino Acid Sequence:

MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV

DECCFRSCDLRRLEMYCAPLKPAKSA.

Purity: Greater than 90.0% as determined by SDS-PAGE.

Formulation:

Lyophilized from a 0.2 μm filtered solution of 300mM HAc-NaAc, pH 6.5

Stability:

Lyophilized LR3 IGF1 althoµgh stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution the LR3 IGF1 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

Usage:

The products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drµgs, agricultural or pesticidal products, food additives or household chemicals.

Solubility:

It is recommended to reconstitute the lyophilized LR3 IGF1 in sterile 18M-cm H2O

LR3-IGF1

 

Introduction:

IGF-1 (Insulin-like growth factor-1) is a major hormonal mediator of statural growth. Under regular circumstances, GH (growth hormone) binds to its receptor in the liver, and other tissues, and stimulates the synthesis/secretion of IGF-1. In target tissues, the Type 1 IGF receptor, that is

homologous to the insulin receptor, is activated by IGF-1, leading to intracellular signaling which stimulates multiple processes leading to statural growth. IGF-1 metabolic actions are partly

directed at stimulating the uptake of glucose, fatty acids, and amino acids so that metabolism supports growing tissues.

Biological Activity:

The ED50 as determined by the stimulation of protein synthesis in L6 myoblasts is less then 1mg/ml, corresponding to a specific activity of 1,000,000 units/mg.

Your Name

Your Email

Inquiry Product

Your Message

Captcha